PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pbr032228.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Pyrus
Family NAC
Protein Properties Length: 317aa    MW: 36088.1 Da    PI: 4.7243
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pbr032228.1genomeCPETRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM1332.1e-41151412128
          NAM   2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk.kge 98 
                  p+GfrF Pt eelv +yLk k ++++++  ++i+e+d+++++PwdL +++ +++  wy Fs++d ky +++r+nrat  g Wk tgk+++++++ +++
  Pbr032228.1  15 PVGFRFYPTPEELVGHYLKLKKQDNDFKS-DHIAEFDVCNFDPWDLAARIPSDDMVWYIFSRKDYKYINSTRSNRATPGGHWKITGKERAIKARrSKA 111
                  89*************************99.89**************99999999**************************************985666 PP

          NAM  99 lvglkktLvfykgrapkgektdWvmheyrl 128
                  ++g k+tL+fy+  +pk++ktdWvmhe+ l
  Pbr032228.1 112 VIGKKRTLTFYQRCQPKPKKTDWVMHEFYL 141
                  79*************************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019419.42E-4913164IPR003441NAC domain
PROSITE profilePS5100545.73914165IPR003441NAC domain
PfamPF023657.9E-2215140IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 317 aa     Download sequence    Send to blast
MGSNRKTRGG GASDPVGFRF YPTPEELVGH YLKLKKQDND FKSDHIAEFD VCNFDPWDLA  60
ARIPSDDMVW YIFSRKDYKY INSTRSNRAT PGGHWKITGK ERAIKARRSK AVIGKKRTLT  120
FYQRCQPKPK KTDWVMHEFY LIDSEASSNP KLHQNDFVLC RMKKNSDMED TSIGEVELGS  180
YSVSNVEDHA AAIVTPEDYS SSTFLSSGYI ELGDIPHGND NIDDCNAMQS PFGYNNYSYP  240
DKNDISTCDE GEPLGFTMSD FENEVPDPMS QEVCPPREEN LELFFYPPQP EDYTLEPLMN  300
MTVGNVLHDN EFRSPI*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4dul_B4e-321316516165NAC domain-containing protein 19
4dul_A4e-321316516165NAC domain-containing protein 19
1ut7_B4e-321316516165NO APICAL MERISTEM PROTEIN
1ut7_A4e-321316516165NO APICAL MERISTEM PROTEIN
1ut4_B4e-321316516165NO APICAL MERISTEM PROTEIN
1ut4_A4e-321316516165NO APICAL MERISTEM PROTEIN
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009376046.11e-152PREDICTED: NAC domain-containing protein 78-like isoform X2
TrEMBLM5XFX42e-73M5XFX4_PRUPE; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF14450518
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G33060.23e-39NAC 014